PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA27901
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 981aa    MW: 108822 Da    PI: 5.1995
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA27901genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.61.3e-28571621252
                     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                ek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Tp57577_TGAC_v2_mRNA27901 571 EKSISLEVLQRYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 621
                                799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.677560641IPR003035RWP-RK domain
PfamPF020421.7E-25574621IPR003035RWP-RK domain
SuperFamilySSF542771.83E-21882970No hitNo description
Gene3DG3DSA:3.10.20.2401.3E-25884966No hitNo description
SMARTSM006667.6E-25884967IPR000270PB1 domain
PROSITE profilePS5174524.364884967IPR000270PB1 domain
PfamPF005642.4E-18884966IPR000270PB1 domain
CDDcd064071.07E-33885966No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 981 aa     Download sequence    Send to blast
MPESEEENQD FPPKTKTSLE EHVCAMDFDL DLETSWPLDH MSFISNPMSP FLFSTISDQP  60
SSPLWDFTDG EDENHNKLAA SAFSDCHKIF SCDSNSITEK PVEKDDNKTL LPPLLPPIEH  120
LDRYCGIKEK MTQALRYFKE LTEMNVLAQV WAPVRNGNRF VLTTSGQPFM LDPHSNGLNQ  180
YRTVSLMYKF SVDGENDGTL GLPGRVFQQK LPEWSPNVLY YSSKEYPRRD HAQHYNVRGT  240
LALPVFEPSL PSCIGVLELI MTSPKINYAP EVEKICKALE AVNLRSSEIL DHPFTQICNE  300
GRQNALSEIL EILTVVCETH NLPLAQTWVP CRHRSVLAHG GGFKKSCSSF DGSCMGQVCM  360
STTEVASYII DAHLWGFREA CVEHHLQHGQ GVAGRAFLSQ NMSFCSNITQ FCKTDYPLVH  420
YALMFGLIGC FAICLRSFYT GDDDYVLEFF LPPGITEFHE QKTLLGSILA TLKEHFQSLK  480
IAAGVELEEN GPIEIIEATD EGIRLRTESI PIAQSIKSPF IPDASPNMEE VPQDDPSGIH  540
GEDIGGSINP MSPLGNKNIK KPSERKRGKT EKSISLEVLQ RYFAGSLKDA AKSLGVCPTT  600
MKRICRQHGI SRWPSRKINK VNRSLSKLKR VIESVQGAEG AFDLNSLSNN QLPIVSSFPE  660
PSTPNKSNQQ GSLNIKPSEP QMKENEFDAS KVSETNIQAV MEDQLLGGRK HSLDKEVIND  720
KGVSIREIGN DRKRTRTRSG SSEDSTNPAS HGSCHGSPPN EISTVKDLFI PSNNEQCIVL  780
RGSPESRVQP TNAFNSPTAH CLPDNVLAEL QEPFGGMLIE DAGSSKDLRN LCPSVAEAIL  840
EDMAPEACGT NLPGSYMAPP KQCMDTINNN NSVMPFAVRK EMKTVTIKAT YREDIIRFRV  900
SLNCGIVELK EEVSKRLKLE VGTFDIKYMD DDNEWVLIAC DADLQECMFV SRSSGGSNII  960
RVLVHDITSN LGSSCESSGE *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1312400.0AC131240.32 Medicago truncatula clone mth2-33j22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003592270.10.0plant regulator RWP-RK family protein
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLG7IAL80.0G7IAL8_MEDTR; Plant regulator RWP-RK family protein
STRINGGLYMA20G29960.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7